| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) ![]() has a additional strand at the N-terminus |
| Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
| Protein automated matches [190558] (13 species) not a true protein |
| Species Cowpea (Vigna unguiculata) [TaxId:3917] [278150] (1 PDB entry) |
| Domain d4tx4b_: 4tx4 B: [278152] automated match to d3ul5d_ complexed with so4 |
PDB Entry: 4tx4 (more details), 1.95 Å
SCOPe Domain Sequences for d4tx4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tx4b_ d.17.1.0 (B:) automated matches {Cowpea (Vigna unguiculata) [TaxId: 3917]}
sleidslarfaveehnkkqnallefgrvvsaqqqvvsgtlytitleakdggqkkvyeakv
wekpwlnfkelqefkhvgd
Timeline for d4tx4b_: