PDB entry 4s10

View 4s10 on RCSB PDB site
Description: Gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
Class: metal binding protein/immune system
Keywords: GELSOLIN-LIKE, ACTIN-BINDING, METAL BINDING PROTEIN-IMMUNE SYSTEM complex
Deposited on 2015-01-07, released 2015-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelsolin nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S10 (0-126)
    Domains in SCOPe 2.07: d4s10a1, d4s10a2
  • Chain 'B':
    Compound: gelsolin nanobody
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4S10 (0-End)
    Domains in SCOPe 2.07: d4s10b1, d4s10b2
  • Chain 'C':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396 (0-End)
      • engineered mutation (67)
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4s10c_
  • Chain 'D':
    Compound: gelsolin
    Species: Homo sapiens [TaxId:9606]
    Gene: GSN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06396 (Start-102)
      • engineered mutation (67)
      • engineered mutation (69)
    Domains in SCOPe 2.07: d4s10d_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4s10A (A:)
    qvqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtry
    adsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqg
    tqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4s10B (B:)
    qvqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtry
    adsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqg
    tqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s10B (B:)
    qvqlqesggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtry
    adsakgrftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqg
    tqvtvs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4s10C (C:)
    vqrlfqvkgrrvvratevpvswesfnngdcfildlgnnihqwcgsnsnryerlkatqvsk
    girdnerdgdarvhvseegtepeamlqvlgpkpalpagtedta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s10C (C:)
    vqrlfqvkgrrvvratevpvswesfnngdcfildlgnnihqwcgsnsnryerlkatqvsk
    girdnerdgdarvhvseegtepeamlqvlgpkpalpagted
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4s10D (D:)
    vqrlfqvkgrrvvratevpvswesfnngdcfildlgnnihqwcgsnsnryerlkatqvsk
    girdnerdgdarvhvseegtepeamlqvlgpkpalpagtedta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4s10D (D:)
    qrlfqvkgrrvvratevpvswesfnngdcfildlgnnihqwcgsnsnryerlkatqvskg
    irdnerdgdarvhvseegtepeamlqvlgpkpalpagtedta