Lineage for d4s10d_ (4s10 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969658Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2969675Species Human (Homo sapiens) [TaxId:9606] [55761] (47 PDB entries)
    Uniprot P20065 55-179
  8. 2969732Domain d4s10d_: 4s10 D: [273444]
    Other proteins in same PDB: d4s10a1, d4s10a2, d4s10b1, d4s10b2
    automated match to d1kcqa_
    complexed with ca; mutant

Details for d4s10d_

PDB Entry: 4s10 (more details), 2.61 Å

PDB Description: gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
PDB Compounds: (D:) gelsolin

SCOPe Domain Sequences for d4s10d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s10d_ d.109.1.1 (D:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}
qrlfqvkgrrvvratevpvswesfnngdcfildlgnnihqwcgsnsnryerlkatqvskg
irdnerdgdarvhvseegtepeamlqvlgpkpalpagtedta

SCOPe Domain Coordinates for d4s10d_:

Click to download the PDB-style file with coordinates for d4s10d_.
(The format of our PDB-style files is described here.)

Timeline for d4s10d_: