Lineage for d4s10a1 (4s10 A:6-127)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2347168Protein automated matches [190119] (19 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (145 PDB entries)
  8. 2347892Domain d4s10a1: 4s10 A:6-127 [273448]
    Other proteins in same PDB: d4s10a2, d4s10b2, d4s10c_, d4s10d_
    automated match to d3stbb_
    complexed with ca; mutant

Details for d4s10a1

PDB Entry: 4s10 (more details), 2.61 Å

PDB Description: gelsolin nanobody shielding mutant plasma gelsolin from furin proteolysis
PDB Compounds: (A:) gelsolin nanobody

SCOPe Domain Sequences for d4s10a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s10a1 b.1.1.1 (A:6-127) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggslrlscaasgrtfssfvmgwfrqapgkerefvasisrsgsvtryadsak
grftiskdnakntvslqmdnlnpddtavyycaadlhrpygpgsqrtddydtwgqgtqvtv
ss

SCOPe Domain Coordinates for d4s10a1:

Click to download the PDB-style file with coordinates for d4s10a1.
(The format of our PDB-style files is described here.)

Timeline for d4s10a1: