PDB entry 4reu

View 4reu on RCSB PDB site
Description: Revelation of Endogenously bound Fe2+ ions in the Crystal Structure of Ferritin from Escherichia coli
Class: oxidoreductase
Keywords: Ferritin, Iron-binding, binuclear metal binding, OXIDOREDUCTASE
Deposited on 2014-09-24, released 2014-10-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.175
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Escherichia coli str. K-12 substr. MDS42 [TaxId:1110693]
    Gene: ftn, ECMDS42_1565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4reua_
  • Chain 'B':
    Compound: Ferritin
    Species: Escherichia coli str. K-12 substr. MDS42 [TaxId:1110693]
    Gene: ftn, ECMDS42_1565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4reub_
  • Chain 'C':
    Compound: Ferritin
    Species: Escherichia coli str. K-12 substr. MDS42 [TaxId:1110693]
    Gene: ftn, ECMDS42_1565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4reuc_
  • Chain 'D':
    Compound: Ferritin
    Species: Escherichia coli str. K-12 substr. MDS42 [TaxId:1110693]
    Gene: ftn, ECMDS42_1565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4reud_
  • Chain 'E':
    Compound: Ferritin
    Species: Escherichia coli str. K-12 substr. MDS42 [TaxId:1110693]
    Gene: ftn, ECMDS42_1565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4reue_
  • Chain 'F':
    Compound: Ferritin
    Species: Escherichia coli str. K-12 substr. MDS42 [TaxId:1110693]
    Gene: ftn, ECMDS42_1565
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4reuf_
  • Heterogens: FE, SO4, MES, CL, HG, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4reuA (A:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4reuB (B:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4reuC (C:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4reuD (D:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4reuE (E:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4reuF (F:)
    lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
    tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
    wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn