| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Non-hem ferritin [63524] (7 species) |
| Species Escherichia coli [TaxId:1110693] [260578] (1 PDB entry) |
| Domain d4reub_: 4reu B: [263857] automated match to d4reua_ complexed with cl, fe, hg, mes, mg, so4 |
PDB Entry: 4reu (more details), 2.5 Å
SCOPe Domain Sequences for d4reub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4reub_ a.25.1.1 (B:) Non-hem ferritin {Escherichia coli [TaxId: 1110693]}
lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl
tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq
wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
Timeline for d4reub_: