![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Non-hem ferritin [63524] (7 species) |
![]() | Species Escherichia coli [TaxId:1110693] [260578] (1 PDB entry) |
![]() | Domain d4reuc_: 4reu C: [263858] automated match to d4reua_ complexed with cl, fe, hg, mes, mg, so4 |
PDB Entry: 4reu (more details), 2.5 Å
SCOPe Domain Sequences for d4reuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4reuc_ a.25.1.1 (C:) Non-hem ferritin {Escherichia coli [TaxId: 1110693]} lkpemieklneqmnlelyssllyqqmsawcsyhtfegaaaflrrhaqeemthmqrlfdyl tdtgnlprintvespfaeyssldelfqetykheqlitqkinelahaamtnqdyptfnflq wyvseqheeeklfksiidklslagksgeglyfidkelstldtqn
Timeline for d4reuc_: