PDB entry 4nic

View 4nic on RCSB PDB site
Description: Crystal structure of Klebsiella pneumoniae RstA BeF3-activated N-terminal receiver domain
Class: transcription regulator
Keywords: Two-Component System, response regulator, TRANSCRIPTION REGULATOR
Deposited on 2013-11-06, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 3.18 Å
R-factor: 0.191
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding transcriptional regulator RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: rstA, KPN2242_10390, KPR_2822
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nica_
  • Chain 'B':
    Compound: DNA-binding transcriptional regulator RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: rstA, KPN2242_10390, KPR_2822
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nicb_
  • Chain 'C':
    Compound: DNA-binding transcriptional regulator RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: rstA, KPN2242_10390, KPR_2822
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nicc_
  • Chain 'D':
    Compound: DNA-binding transcriptional regulator RstA
    Species: Klebsiella pneumoniae [TaxId:573]
    Gene: rstA, KPN2242_10390, KPR_2822
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4nicd_
  • Heterogens: MG, BEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4nicA (A:)
    mhhhhhhamgnkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvll
    dimlpgkdgmtlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllar
    lrlhlrqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nicA (A:)
    nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm
    tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4nicB (B:)
    mhhhhhhamgnkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvll
    dimlpgkdgmtlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllar
    lrlhlrqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nicB (B:)
    nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm
    tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4nicC (C:)
    mhhhhhhamgnkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvll
    dimlpgkdgmtlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllar
    lrlhlrqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nicC (C:)
    nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm
    tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4nicD (D:)
    mhhhhhhamgnkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvll
    dimlpgkdgmtlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllar
    lrlhlrqh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4nicD (D:)
    nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm
    tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq