Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (86 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [225322] (2 PDB entries) |
Domain d4nicb_: 4nic B: [345363] automated match to d5dcla_ complexed with bef, mg |
PDB Entry: 4nic (more details), 3.18 Å
SCOPe Domain Sequences for d4nicb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nicb_ c.23.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq
Timeline for d4nicb_: