Lineage for d4nica_ (4nic A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2438295Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2438674Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2438675Protein automated matches [190131] (73 species)
    not a true protein
  7. 2438832Species Klebsiella pneumoniae [TaxId:573] [225322] (2 PDB entries)
  8. 2438835Domain d4nica_: 4nic A: [345362]
    automated match to d5dcla_
    complexed with bef, mg

Details for d4nica_

PDB Entry: 4nic (more details), 3.18 Å

PDB Description: Crystal structure of Klebsiella pneumoniae RstA BeF3-activated N-terminal receiver domain
PDB Compounds: (A:) DNA-binding transcriptional regulator RstA

SCOPe Domain Sequences for d4nica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nica_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
nkivfveddpevgtliaaylgkhdmdvvveprgdraeeviarekpdlvlldimlpgkdgm
tlcrdlrgqwqgpivlltsldsdmnhilslemgasdyilkttppavllarlrlhlrq

SCOPe Domain Coordinates for d4nica_:

Click to download the PDB-style file with coordinates for d4nica_.
(The format of our PDB-style files is described here.)

Timeline for d4nica_:

  • d4nica_ is new in SCOPe 2.07-stable