PDB entry 4n7f

View 4n7f on RCSB PDB site
Description: Crystal structure of 3rd WW domain of human Nedd4-1
Class: protein binding
Keywords: beta sheet, WW domain, target binding, proline rich region, cytosolic, PROTEIN BINDING
Deposited on 2013-10-15, released 2014-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.182
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase NEDD4
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0093, NEDD4, NEDD4-1, PIG53
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46934 (4-End)
    • expression tag (0-3)
  Domains in SCOPe 2.04: d4n7fa_
• Chain 'B':
  Compound: E3 ubiquitin-protein ligase NEDD4
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA0093, NEDD4, NEDD4-1, PIG53
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46934 (4-End)
    • expression tag (0-3)
  Domains in SCOPe 2.04: d4n7fb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4n7fA (A:)
  amgsflpkgwevrhapngrpffidhntktttwedprlk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4n7fA (A:)
  amgsflpkgwevrhapngrpffidhntktttwedprl
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4n7fB (B:)
  amgsflpkgwevrhapngrpffidhntktttwedprlk
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4n7fB (B:)
  amgsflpkgwevrhapngrpffidhntktttwedprl