SCOPe 2.04: Domain d4n7fa_: 4n7f A:

Lineage for d4n7fa_ (4n7f A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.0: automated matches [227264] (1 protein)
   not a true family

6. Protein automated matches [227055] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226058] (8 PDB entries)

8. Domain d4n7fa_: 4n7f A: [236614]
   automated match to d4n7fb_

Details for d4n7fa_

PDB Entry: 4n7f, 1.1 Å

PDB Description: Crystal structure of 3rd WW domain of human Nedd4-1

PDB Compounds: (A:) E3 ubiquitin-protein ligase NEDD4

SCOPe Domain Sequences for d4n7fa_:

Sequence; same for both SEQRES and ATOM records:

>d4n7fa_ b.72.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
amgsflpkgwevrhapngrpffidhntktttwedprl

Timeline for d4n7fa_:

• d4n7fa_ first appeared in SCOPe 2.03
  
• d4n7fa_ appears in SCOPe 2.05
  
• d4n7fa_ appears in the current release, SCOPe 2.08, called d4n7fa1