PDB entry 4lrn

View 4lrn on RCSB PDB site
Description: Ontogeny of recognition specificity and functionality for the anti-HIV antibody 4E10
Class: immune system
Keywords: germline, HIV, immunoglobulin, Fv portion of Ab, 4E10 epitope, IMMUNE SYSTEM
Deposited on 2013-07-20, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.19
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: GEP 1 heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LRN (Start-126)
    Domains in SCOPe 2.04: d4lrnh_
  • Chain 'L':
    Compound: GEP 1 light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LRN (0-110)
    Domains in SCOPe 2.04: d4lrnl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4lrnH (H:)
    qvqlvqsgaevkkpgssvkvsckasggtfssyaiswvrqapgqglewmggiipifgtany
    aqkfqgrvtitadkststaymelsslrsedtavyycaregttgwgwlgkpigafaywgqg
    tlvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lrnH (H:)
    qlvqsgaevkkpgssvkvsckasaiswvrqapgqglewmggiipifgtanyaqkfqgrvt
    itadkststaymelsslrsedtavyycareggwlgkpigafaywgqgtlvtvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lrnL (L:)
    meivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgi
    pdrfsgsgsgtdftltisrlepedfavyycqqygsspstfgqgtkveikrl