SCOPe 2.04: Domain d4lrnl_: 4lrn L:

Lineage for d4lrnl_ (4lrn L:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4lrnl_: 4lrn L: [260172]
   automated match to d3zhda_

Details for d4lrnl_

PDB Entry: 4lrn, 1.89 Å

PDB Description: Ontogeny of recognition specificity and functionality for the anti-HIV antibody 4E10

PDB Compounds: (L:) GEP 1 light chain

SCOPe Domain Sequences for d4lrnl_:

Sequence; same for both SEQRES and ATOM records:

>d4lrnl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
meivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgi
pdrfsgsgsgtdftltisrlepedfavyycqqygsspstfgqgtkveikrl

Timeline for d4lrnl_:

• d4lrnl_ is new in SCOPe 2.04-stable
  
• d4lrnl_ appears in SCOPe 2.05
  
• d4lrnl_ appears in the current release, SCOPe 2.08