PDB entry 4jcm

View 4jcm on RCSB PDB site
Description: Crystal structure of Gamma-CGTASE from Alkalophilic bacillus clarkii at 1.65 Angstrom resolution
Class: transferase
Keywords: ibeta/alpha j8 barrel, alpha-amylase family, cyclization, binding glucose, binding cation calcium, transferase
Deposited on 2013-02-22, released 2014-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.129
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclodextrin glucanotransferase
    Species: Bacillus clarkii [TaxId:79879]
    Gene: cgt
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jcma1, d4jcma2, d4jcma3, d4jcma4
  • Heterogens: CA, CL, NA, SO4, GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jcmA (A:)
    mfrkllctlvtiitlsawivshggevhasnatndlsnvnyaeeviyhivtdrfkdgdpdn
    npqgqlfsngcsdltkycggdwqgiideiesgylpdmgitalwisppvenvfdlhpegfs
    syhgywardfkktnpffgdfddfsrlietahahdikvvidfvpnhtspvdiedgalydng
    tllghystdannyfynyggsdfsdyensiyrnlydlaslnqqhsfidkylkesiqlwldt
    gidgirvdavahmplgwqkafissvydynpvftfgewftgaqgsnhyhhfvnnsgmsald
    fryaqvaqdvlrnqkgtmhdiydmlastqldyerpqdqvtfidnhdidrftvegrdtrtt
    diglaflltsrgvpaiyygtenymtgkgdpgnrkmmesfdqtttayqviqklaplrqenk
    avaygstkerwinddvliyersfngdyllvainknvnqaytisglltempaqvyhdvlds
    lldgqslavkengtvdsfllgpgevsvwqhisesgsapvigqvgppmgkpgdavkisgsg
    fgsepgtvyfrdtkidvltwddetivitlpetlggkaqisvtnsdgvtsngydfqlltgk
    qesvrfvvdnahtnygenvylvgnvpelgnwnpadaigpmfnqvvysyptwyydvsvpad
    talefkfiivdgngnvtwesggnhnyrvtsgstdtvrvsfrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jcmA (A:)
    dlsnvnyaeeviyhivtdrfkdgdpdnnpqgqlfsngcsdltkycggdwqgiideiesgy
    lpdmgitalwisppvenvfdlhpegfssyhgywardfkktnpffgdfddfsrlietahah
    dikvvidfvpnhtspvdiedgalydngtllghystdannyfynyggsdfsdyensiyrnl
    ydlaslnqqhsfidkylkesiqlwldtgidgirvdavahmplgwqkafissvydynpvft
    fgewftgaqgsnhyhhfvnnsgmsaldfryaqvaqdvlrnqkgtmhdiydmlastqldye
    rpqdqvtfidnhdidrftvegrdtrttdiglaflltsrgvpaiyygtenymtgkgdpgnr
    kmmesfdqtttayqviqklaplrqenkavaygstkerwinddvliyersfngdyllvain
    knvnqaytisglltempaqvyhdvldslldgqslavkengtvdsfllgpgevsvwqhise
    sgsapvigqvgppmgkpgdavkisgsgfgsepgtvyfrdtkidvltwddetivitlpetl
    ggkaqisvtnsdgvtsngydfqlltgkqesvrfvvdnahtnygenvylvgnvpelgnwnp
    adaigpmfnqvvysyptwyydvsvpadtalefkfiivdgngnvtwesggnhnyrvtsgst
    dtvrvsfrr