Lineage for d4jcma3 (4jcm A:487-568)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766154Species Bacillus clarkii [TaxId:79879] [256323] (1 PDB entry)
  8. 2766155Domain d4jcma3: 4jcm A:487-568 [252888]
    Other proteins in same PDB: d4jcma1, d4jcma2, d4jcma4
    automated match to d1cyga1
    complexed with ca, cl, edo, gol, na, so4

Details for d4jcma3

PDB Entry: 4jcm (more details), 1.65 Å

PDB Description: Crystal structure of Gamma-CGTASE from Alkalophilic bacillus clarkii at 1.65 Angstrom resolution
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d4jcma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcma3 b.1.18.0 (A:487-568) automated matches {Bacillus clarkii [TaxId: 79879]}
gsapvigqvgppmgkpgdavkisgsgfgsepgtvyfrdtkidvltwddetivitlpetlg
gkaqisvtnsdgvtsngydfql

SCOPe Domain Coordinates for d4jcma3:

Click to download the PDB-style file with coordinates for d4jcma3.
(The format of our PDB-style files is described here.)

Timeline for d4jcma3: