| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Bacillus clarkii [TaxId:79879] [256323] (1 PDB entry) |
| Domain d4jcma3: 4jcm A:487-568 [252888] Other proteins in same PDB: d4jcma1, d4jcma2, d4jcma4 automated match to d1cyga1 complexed with ca, cl, edo, gol, na, so4 |
PDB Entry: 4jcm (more details), 1.65 Å
SCOPe Domain Sequences for d4jcma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jcma3 b.1.18.0 (A:487-568) automated matches {Bacillus clarkii [TaxId: 79879]}
gsapvigqvgppmgkpgdavkisgsgfgsepgtvyfrdtkidvltwddetivitlpetlg
gkaqisvtnsdgvtsngydfql
Timeline for d4jcma3: