Lineage for d4jcma1 (4jcm A:6-396)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832430Species Bacillus clarkii [TaxId:79879] [256320] (1 PDB entry)
  8. 2832431Domain d4jcma1: 4jcm A:6-396 [252886]
    Other proteins in same PDB: d4jcma2, d4jcma3, d4jcma4
    automated match to d1cyga4
    complexed with ca, cl, edo, gol, na, so4

Details for d4jcma1

PDB Entry: 4jcm (more details), 1.65 Å

PDB Description: Crystal structure of Gamma-CGTASE from Alkalophilic bacillus clarkii at 1.65 Angstrom resolution
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d4jcma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcma1 c.1.8.0 (A:6-396) automated matches {Bacillus clarkii [TaxId: 79879]}
dlsnvnyaeeviyhivtdrfkdgdpdnnpqgqlfsngcsdltkycggdwqgiideiesgy
lpdmgitalwisppvenvfdlhpegfssyhgywardfkktnpffgdfddfsrlietahah
dikvvidfvpnhtspvdiedgalydngtllghystdannyfynyggsdfsdyensiyrnl
ydlaslnqqhsfidkylkesiqlwldtgidgirvdavahmplgwqkafissvydynpvft
fgewftgaqgsnhyhhfvnnsgmsaldfryaqvaqdvlrnqkgtmhdiydmlastqldye
rpqdqvtfidnhdidrftvegrdtrttdiglaflltsrgvpaiyygtenymtgkgdpgnr
kmmesfdqtttayqviqklaplrqenkavay

SCOPe Domain Coordinates for d4jcma1:

Click to download the PDB-style file with coordinates for d4jcma1.
(The format of our PDB-style files is described here.)

Timeline for d4jcma1: