PDB entry 4i52

View 4i52 on RCSB PDB site
Description: scMenB im complex with 1-hydroxy-2-naphthoyl-CoA
Class: lyase
Keywords: crotonase, 1,4-dihydroxy-2-naphthoyl coenzyme A synthase, LYASE
Deposited on 2012-11-28, released 2013-05-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.23
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (0-274)
  Domains in SCOPe 2.02: d4i52a_
• Chain 'B':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (0-274)
• Chain 'C':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (Start-274)
• Chain 'D':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (0-274)
• Chain 'E':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (Start-274)
• Chain 'F':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (Start-274)
• Chain 'G':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (0-274)
• Chain 'H':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (0-274)
• Chain 'I':
  Compound: naphthoate synthase
  Species: Synechocystis sp. [TaxId:1111708]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P73495 (0-274)
• Heterogens: 1HA, CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4i52A (A:)
  mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll
  tgagphsdgkyafcsggdqsvrgeggyiddqgtprlnvldlqrlirsmpkvvialvagya
  iggghvlhlvcdltiaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqy
  saqeaermgmvntvvpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqela
  gnatllyymteegsegkqaflekrppdfsqypwlp
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.