Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (20 species) not a true protein |
Species Synechocystis sp. [TaxId:1111708] [197025] (2 PDB entries) |
Domain d4i52a_: 4i52 A: [197398] automated match to d2iexc_ complexed with 1ha, cl |
PDB Entry: 4i52 (more details), 2.35 Å
SCOPe Domain Sequences for d4i52a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i52a_ c.14.1.0 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]} mdwhiakhyddilyykaggiakivinrphkrnafrpqtvfelydafcnarednrigvvll tgagphsdgkyafcsggdqsvrgeggyiddqgtprlnvldlqrlirsmpkvvialvagya iggghvlhlvcdltiaadnaifgqtgpkvgsfdggfgssylarivgqkkareiwylcrqy saqeaermgmvntvvpvdrleeegiqwakeilsksplairclkaafnadcdgqaglqela gnatllyymteegsegkqaflekrppdfsqypwlp
Timeline for d4i52a_: