PDB entry 4f1s

View 4f1s on RCSB PDB site
Description: Crystal structure of human PI3K-gamma in complex with a pyridyl-triazine-sulfonamide inhibitor
Class: Transferase/Inhibitor
Keywords: phosphotransferase, lipid kinase, p85, Transferase-Inhibitor complex
Deposited on 2012-05-07, released 2012-08-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.196
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4f1sa1, d4f1sa2, d4f1sa3, d4f1sa4
  • Heterogens: SO4, F1S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4f1sA (A:)
    gseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4f1sA (A:)
    sqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvtskp
    lpeylwkkianncifivihrsttsqtikvspddtpgailqsfdfvlrvcgrdeylvgetp
    iknfqwvrhclkngeeihvvldtppdpaldevrkeewvslwdcdrkfrvkirgidipvld
    ltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkv
    qllyyvnlllidhrfllrrgeyvlhmwqissfnadkltsatnpdkensmsisilldnpia
    lpkhqaempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwg
    qqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhy
    llqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavilea
    ylrgcgtamlhdftqqvqviemlqkvtldikslsadvssqvisqlkqklenlqnsqlpes
    frvpydpglkagalaiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdm
    lilqilrimesiwetesldlcllpygcistgdkigmieivkdattiakiqqstvggafkd
    evlnhwlkekspteekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhid
    fgkervpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmt
    gmpqltskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlv