PDB entry 4eix

View 4eix on RCSB PDB site
Description: Structural Studies of the ternary complex of Phaspholipase A2 with nimesulide and indomethacin
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2012-04-06, released 2012-04-25
The last revision prior to the SCOPe 2.02 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.184
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 VRV-PL-VIIIa
  Species: Daboia russellii pulchella [TaxId:97228]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0VX11 (0-120)
  Domains in SCOPe 2.02: d4eixa_
• Heterogens: NIM, IMN, CCN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4eixA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c