Lineage for d4eixa_ (4eix A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1099130Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 1099131Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 1099136Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
  6. 1099243Protein Snake phospholipase A2 [48624] (35 species)
  7. 1099429Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (30 PDB entries)
    Uniprot P59071
  8. 1099467Domain d4eixa_: 4eix A: [192378]
    automated match to d1tk4a_
    complexed with ccn, imn, nim

Details for d4eixa_

PDB Entry: 4eix (more details), 2.9 Å

PDB Description: Structural Studies of the ternary complex of Phaspholipase A2 with nimesulide and indomethacin
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d4eixa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eixa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d4eixa_:

Click to download the PDB-style file with coordinates for d4eixa_.
(The format of our PDB-style files is described here.)

Timeline for d4eixa_: