PDB entry 4e0h

View 4e0h on RCSB PDB site
Description: Crystal structure of FAD binding domain of Erv1 from Saccharomyces cerevisiae
Class: oxidoreductase
Keywords: four-helix bundle, Flavin-linked sulfhydryl oxidase, FAD binding, oxidation, mitochondrial intermembrane space, OXIDOREDUCTASE
Deposited on 2012-03-04, released 2012-08-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial FAD-linked sulfhydryl oxidase ERV1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: ERV1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27882 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.02: d4e0ha_
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4e0hA (A:)
    hmdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnwcakdfekyire
    napqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4e0hA (A:)
    hmdveqlgrsswtllhsvaasypaqptdqqkgemkqflnifshiypcnwcakdfekyire
    napqvesreelgrwmceahnkvnkklrkpkfdcnfwekrwkdgwd