PDB entry 4do2

View 4do2 on RCSB PDB site
Description: Crystal Structure of the Rop protein mutant D30P/A31G at resolution 1.4 resolution.
Class: RNA binding protein
Keywords: protein structure, protein folding, Rop protein, bacterial protein, mutation, 4-alpha-helical bundle, loop, RNA binding protein, ColE1 plasmid copy number
Deposited on 2012-02-09, released 2013-02-13
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.16
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-End)
      • engineered mutation (29-30)
    Domains in SCOPe 2.02: d4do2a_
  • Chain 'B':
    Compound: Regulatory protein rop
    Species: Escherichia coli [TaxId:562]
    Gene: ROP
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-End)
      • engineered mutation (29-30)
    Domains in SCOPe 2.02: d4do2b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4do2A (A:)
mtkqektalnmarfirsqtltlleklnelpgdeqadiceslhdhadelyrsclarfgddg
enlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4do2A (A:)
mtkqektalnmarfirsqtltlleklnelpgdeqadiceslhdhadelyrsclarfg

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4do2B (B:)
mtkqektalnmarfirsqtltlleklnelpgdeqadiceslhdhadelyrsclarfgddg
enlehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4do2B (B:)
mtkqektalnmarfirsqtltlleklnelpgdeqadiceslhdhadelyrsclarfg