Lineage for d4do2b_ (4do2 B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1086923Fold a.30: ROP-like [47379] (8 superfamilies)
    4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist
  4. 1086924Superfamily a.30.1: ROP protein [47380] (1 family) (S)
  5. 1086925Family a.30.1.1: ROP protein [47381] (1 protein)
  6. 1086926Protein ROP protein [47382] (1 species)
  7. 1086927Species Escherichia coli [TaxId:562] [47383] (17 PDB entries)
    Uniprot P03051
  8. 1086930Domain d4do2b_: 4do2 B: [194013]
    automated match to d1rpra_
    mutant

Details for d4do2b_

PDB Entry: 4do2 (more details), 1.4 Å

PDB Description: Crystal Structure of the Rop protein mutant D30P/A31G at resolution 1.4 resolution.
PDB Compounds: (B:) Regulatory protein rop

SCOPe Domain Sequences for d4do2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4do2b_ a.30.1.1 (B:) ROP protein {Escherichia coli [TaxId: 562]}
mtkqektalnmarfirsqtltlleklnelpgdeqadiceslhdhadelyrsclarfg

SCOPe Domain Coordinates for d4do2b_:

Click to download the PDB-style file with coordinates for d4do2b_.
(The format of our PDB-style files is described here.)

Timeline for d4do2b_:

1086930
d4do2b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d4do2a_