PDB entry 4cxa

View 4cxa on RCSB PDB site
Description: Crystal structure of the human CDK12-cyclin K complex bound to AMPPNP
Class: transferase
Keywords: transferase, kinase
Deposited on 2014-04-04, released 2014-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-09, with a file datestamp of 2015-12-04.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cxaa_
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cxab1, d4cxab2
  • Chain 'C':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cxac_
  • Chain 'D':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4cxad1, d4cxad2
  • Heterogens: ANP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cxaA (A:)
    smtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqdchelwskkrrrqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxaA (A:)
    dwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireiki
    lrqlihrsvvnmkeivtdkqldfkkdkgafylvfeymdhdlmgllesglvhfsedhiksf
    mkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseerpytnkvitlw
    yrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavw
    pdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdfl
    kdvelskmappdlphwqdchelwskkrrrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4cxaB (B:)
    smsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhy
    dtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvq
    fgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtf
    vndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvle
    dichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxaB (B:)
    tkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfh
    rfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkee
    vmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlsl
    qwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlys
    qgkqqm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4cxaC (C:)
    smtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqdchelwskkrrrqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxaC (C:)
    dwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireiki
    lrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfsedhik
    sfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvi
    tlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcp
    avwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqs
    dflkdvelskmappdlphwqdchelwskkrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4cxaD (D:)
    smsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhy
    dtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvq
    fgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtf
    vndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvle
    dichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cxaD (D:)
    pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf
    ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm
    vlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqw
    epeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysqg
    k