PDB entry 4coc

View 4coc on RCSB PDB site
Description: HIV-1 capsid C-terminal domain mutant (Y169L)
Class: viral protein
Keywords: viral protein, virus assembly, helical reconstruction,
Deposited on 2014-01-28, released 2014-06-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.1884
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: capsid protein p24
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497
    • engineered mutation (23)
  Domains in SCOPe 2.04: d4coca_
• Chain 'B':
  Compound: capsid protein p24
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497 (Start-85)
    • engineered mutation (23)
• Chain 'C':
  Compound: capsid protein p24
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12497
    • engineered mutation (23)
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4cocA (A:)
  sptsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkal
  gpgatleemmtacqgvggpghkarvl
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4cocA (A:)
  tsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkalgp
  gatleemmtacqgvgg
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.