PDB entry 4coc

View 4coc on RCSB PDB site
Description: HIV-1 capsid C-terminal domain mutant (Y169L)
Class: viral protein
Keywords: viral protein, virus assembly, helical reconstruction,
Deposited on 2014-01-28, released 2014-06-04
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 1.59 Å
R-factor: 0.1884
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (23)
    Domains in SCOPe 2.04: d4coca_
  • Chain 'B':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497 (Start-85)
      • engineered mutation (23)
  • Chain 'C':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12497
      • engineered mutation (23)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4cocA (A:)
    sptsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkal
    gpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4cocA (A:)
    tsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkalgp
    gatleemmtacqgvgg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.