Lineage for d4coca_ (4coc A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487635Protein automated matches [226861] (3 species)
    not a true protein
  7. 1487639Species Human immunodeficiency virus 1 [TaxId:11676] [224990] (6 PDB entries)
  8. 1487641Domain d4coca_: 4coc A: [256638]
    automated match to d2xt1a_
    complexed with so4; mutant

Details for d4coca_

PDB Entry: 4coc (more details), 1.59 Å

PDB Description: HIV-1 capsid C-terminal domain mutant (Y169L)
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d4coca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4coca_ a.28.3.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrflktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgvgg

SCOPe Domain Coordinates for d4coca_:

Click to download the PDB-style file with coordinates for d4coca_.
(The format of our PDB-style files is described here.)

Timeline for d4coca_: