PDB entry 4ay0
View 4ay0 on RCSB PDB site
Description: High resolution crystal structure of the monomeric subunit-free Caf1M chaperone
Class: chaperone
Keywords: chaperone, amino acid motifs, bacterial capsules, bacterial proteins, gene expression regulation, molecular chaperones, protein binding, protein conformation
Deposited on
2012-06-16, released
2012-09-26
The last revision prior to the SCOPe 2.08 freeze date was dated
2012-11-21, with a file datestamp of
2012-11-16.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.1668
AEROSPACI score: 0.64
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chaperone protein Caf1M
Species: Yersinia pestis [TaxId:632]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4ay0a1, d4ay0a2 - Chain 'B':
Compound: Chaperone protein Caf1M
Species: Yersinia pestis [TaxId:632]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4ay0b1, d4ay0b2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4ay0A (A:)
aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainnc
ikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippk
stwafdlpkglagarnvswriindqggldrlysknvtl
Sequence, based on observed residues (ATOM records): (download)
>4ay0A (A:)
gvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrlda
kqqnslriaqaggvfprdkeslkwlcvkgippncikllvrpnelkgtpiqfaenlswkvd
ggkliaenpspfymnigeltfggksipshyippkstwafdllagarnvswriindqggld
rlysknvt
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4ay0B (B:)
aqpdikfaskeygvtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedp
fvvtpplfrldakqqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainnc
ikllvrpnelkgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippk
stwafdlpkglagarnvswriindqggldrlysknvtl
Sequence, based on observed residues (ATOM records): (download)
>4ay0B (B:)
vtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrldak
qqnslriaqafprdkeslkwlcvkgippnncikllvrpnelkgtpiqfaenlswkvdggk
liaenpspfymnigeltfggksipshyippkstwafdlpkglagarnvswriindqggld
rlysknvtl