| Class b: All beta proteins [48724] (180 folds) |
| Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) ![]() |
| Family b.7.2.0: automated matches [227280] (1 protein) not a true family |
| Protein automated matches [227091] (2 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [226477] (3 PDB entries) |
| Domain d4ay0b2: 4ay0 B:131-218 [219204] Other proteins in same PDB: d4ay0a1, d4ay0b1 automated match to d1l4ia2 |
PDB Entry: 4ay0 (more details), 1.52 Å
SCOPe Domain Sequences for d4ay0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ay0b2 b.7.2.0 (B:131-218) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvtl
Timeline for d4ay0b2: