SCOPe 2.08: Domain d4ay0b2: 4ay0 B:131-218

Lineage for d4ay0b2 (4ay0 B:131-218)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.0: automated matches [227280] (1 protein)
   not a true family

6. Protein automated matches [227091] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226477] (3 PDB entries)

8. Domain d4ay0b2: 4ay0 B:131-218 [219204]
   Other proteins in same PDB: d4ay0a1, d4ay0b1
   automated match to d1l4ia2

Details for d4ay0b2

PDB Entry: 4ay0, 1.52 Å

PDB Description: High resolution crystal structure of the monomeric subunit-free Caf1M chaperone

PDB Compounds: (B:) Chaperone protein Caf1M

SCOPe Domain Sequences for d4ay0b2:

Sequence; same for both SEQRES and ATOM records:

>d4ay0b2 b.7.2.0 (B:131-218) automated matches {Yersinia pestis [TaxId: 632]}
kgtpiqfaenlswkvdggkliaenpspfymnigeltfggksipshyippkstwafdlpkg
lagarnvswriindqggldrlysknvtl

Timeline for d4ay0b2:

• d4ay0b2 first appeared in SCOPe 2.03
  
• d4ay0b2 appears in SCOPe 2.07