| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
| Family b.1.11.0: automated matches [227286] (1 protein) not a true family |
| Protein automated matches [227104] (3 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [226808] (1 PDB entry) |
| Domain d4ay0b1: 4ay0 B:14-130 [219203] Other proteins in same PDB: d4ay0a2, d4ay0b2 automated match to d1l4ia1 |
PDB Entry: 4ay0 (more details), 1.52 Å
SCOPe Domain Sequences for d4ay0b1:
Sequence, based on SEQRES records: (download)
>d4ay0b1 b.1.11.0 (B:14-130) automated matches {Yersinia pestis [TaxId: 632]}
vtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrldak
qqnslriaqaggvfprdkeslkwlcvkgippkdediwvdvqfainncikllvrpnel
>d4ay0b1 b.1.11.0 (B:14-130) automated matches {Yersinia pestis [TaxId: 632]}
vtigesriiypldaagvmvsvkntqdypvliqsriydenkekesedpfvvtpplfrldak
qqnslriaqafprdkeslkwlcvkgippnncikllvrpnel
Timeline for d4ay0b1: