PDB entry 4ar6

View 4ar6 on RCSB PDB site
Description: X-ray crystallographic structure of the reduced form perdeuterated Pyrococcus furiosus rubredoxin at 295 K (in quartz capillary) to 0.92 Angstroms resolution.
Class: electron transport
Keywords: electron transport
Deposited on 2012-04-20, released 2012-12-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-01-30, with a file datestamp of 2013-01-25.
Experiment type: XRAY
Resolution: 0.92 Å
R-factor: 0.1288
AEROSPACI score: 1.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d4ar6a_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ar6A (A:)
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled