SCOPe 2.02: Domain d4ar6a_: 4ar6 A:

Lineage for d4ar6a_ (4ar6 A:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Pyrococcus furiosus [TaxId:2261] [57809] (24 PDB entries)
   Uniprot P24297

8. Domain d4ar6a_: 4ar6 A: [192572]
   automated match to d3kyua_
   complexed with dod, fe

Details for d4ar6a_

PDB Entry: 4ar6, 0.92 Å

PDB Description: X-ray crystallographic structure of the reduced form perdeuterated Pyrococcus furiosus rubredoxin at 295 K (in quartz capillary) to 0.92 Angstroms resolution.

PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d4ar6a_:

Sequence; same for both SEQRES and ATOM records:

>d4ar6a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

Timeline for d4ar6a_:

• d4ar6a_ is new in SCOPe 2.02-stable
  
• d4ar6a_ appears in SCOPe 2.03
  
• d4ar6a_ appears in the current release, SCOPe 2.08