PDB entry 3se6

View 3se6 on RCSB PDB site
Description: Crystal structure of the human Endoplasmic Reticulum Aminopeptidase 2
Class: hydrolase
Keywords: Thermolysin-like catalytic domain, Aminopeptidase, Zinc binding, Glycosylation, Endoplasmic Reticulum, HYDROLASE
Deposited on 2011-06-10, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-21, with a file datestamp of 2012-03-16.
Experiment type: XRAY
Resolution: 3.08 Å
R-factor: 0.215
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmic reticulum aminopeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP2, LRAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P179 (Start-959)
      • see remark 999 (391)
      • expression tag (960)
    Domains in SCOPe 2.07: d3se6a1, d3se6a2, d3se6a3, d3se6a4, d3se6a5
  • Chain 'B':
    Compound: Endoplasmic reticulum aminopeptidase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ERAP2, LRAP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6P179 (Start-959)
      • see remark 999 (391)
      • expression tag (960)
    Domains in SCOPe 2.07: d3se6b1, d3se6b2, d3se6b3, d3se6b4, d3se6b5
  • Heterogens: ZN, LYS, NAG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3se6A (A:)
    mvhssamvnshrkpmfnihrgfycltailpqicicsqfsvpssyhftedpgafpvatnge
    rfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskdleitna
    tlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfy
    kstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvk
    tielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyal
    qaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasd
    klwvtrviahelahqwfgnlvtmewwndiwlnegfakymeliavnatypelqfddyflnv
    cfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiq
    ylkkfsyrnaknddlwsslsnsclesdftsggvchsdpkmtsnmlaflgenaevkemmtt
    wtlqkgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvi
    hrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrv
    glihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdise
    nlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmes
    sgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllkl
    ielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisg
    ttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvnt
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3se6A (A:)
    pvatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhsk
    dleitnatlqseeymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgf
    egfykstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnm
    pkvktielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqt
    hyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpkts
    sasdklwvtrviahelahqwfgnlvtmewwndiwlnegfakymeliavnatypelqfddy
    flnvcfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqk
    giiqylkkfsyrnaknddlwsslsnslgenaevkemmttwtlqkgipllvvkqdgcslrl
    qqerflqgqerylwhipltystsssnvihrhilksktdtldlpektswvkfnvdsngyyi
    vhyeghgwdqlitqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhets
    spalleglsylesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrs
    allklacdlnhapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqy
    elsmssaeqnkilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqla
    wdfvrenwthllkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifq
    tvletitknikwleknlptlrtwlmvntr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3se6B (B:)
    mvhssamvnshrkpmfnihrgfycltailpqicicsqfsvpssyhftedpgafpvatnge
    rfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskdleitna
    tlqseedsrymkpgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfy
    kstyrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvk
    tielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyal
    qaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasd
    klwvtrviahelahqwfgnlvtmewwndiwlnegfakymeliavnatypelqfddyflnv
    cfevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiq
    ylkkfsyrnaknddlwsslsnsclesdftsggvchsdpkmtsnmlaflgenaevkemmtt
    wtlqkgipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvi
    hrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdqlitqlnqnhtllrpkdrv
    glihdvfqlvgagrltldkaldmtyylqhetsspalleglsylesfyhmmdrrnisdise
    nlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdlnhapciqkaaelfsqwmes
    sgklniptdvlkivysvgaqttagwnylleqyelsmssaeqnkilyalstskhqekllkl
    ielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwthllkkfdlgsydirmiisg
    ttahfsskdklqevklffesleaqgshldifqtvletitknikwleknlptlrtwlmvnt
    rhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3se6B (B:)
    vatngerfpwqelrlpsvviplhydlfvhpnltsldfvasekievlvsnatqfiilhskd
    leitnatlqsepgkelkvlsypaheqiallvpekltphlkyyvamdfqaklgdgfegfyk
    styrtlggetrilavtdfeptqarmafpcfdeplfkanfsikirresrhialsnmpkvkt
    ielegglledhfettvkmstylvayivcdfhslsgftssgvkvsiyaspdkrnqthyalq
    aslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasdk
    lwvtrviahelahqwfgnlvtmewwndiwlnegfakymeliavnatypelqfddyflnvc
    fevitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiqy
    lkkfsyrnaknddlwsslsnsaevkemmttwtlqkgipllvvkqdgcslrlqqerflqgv
    rylwhipltystsssnvihrhilksktdtldlpektswvkfnvdsngyyivhyeghgwdq
    litqlnqnhtllrpkdrvglihdvfqlvgagrltldkaldmtyylqhetsspalleglsy
    lesfyhmmdrrnisdisenlkryllqyfkpvidrqswsdkgsvwdrmlrsallklacdln
    hapciqkaaelfsqwmessgklniptdvlkivysvgaqttagwnylleqyelsmssaeqn
    kilyalstskhqekllklielgmegkviktqnlaallhaiarrpkgqqlawdfvrenwth
    llkkfdlgsydirmiisgttahfsskdklqevklffesleaqgshldifqtvletitkni
    kwleknlptlrtwlmvntr