| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) ![]() same topology as (b.1.15.1) |
| Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
| Protein automated matches [254707] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255965] (22 PDB entries) |
| Domain d3se6a3: 3se6 A:547-637 [249387] Other proteins in same PDB: d3se6a1, d3se6a2, d3se6a4, d3se6a5, d3se6b1, d3se6b2, d3se6b4, d3se6b5 automated match to d2yd0a3 complexed with lys, mes, nag, zn |
PDB Entry: 3se6 (more details), 3.08 Å
SCOPe Domain Sequences for d3se6a3:
Sequence, based on SEQRES records: (download)
>d3se6a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgvfqedpewralqerylwhipltystsssnvihrhilk
sktdtldlpektswvkfnvdsngyyivhyeg
>d3se6a3 b.1.30.0 (A:547-637) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipllvvkqdgcslrlqqerflqgqerylwhipltystsssnvihrhilksktdtldlpek
tswvkfnvdsngyyivhyeg
Timeline for d3se6a3: