Lineage for d3se6b2 (3se6 B:272-546)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530208Species Human (Homo sapiens) [TaxId:9606] [188286] (57 PDB entries)
  8. 2530270Domain d3se6b2: 3se6 B:272-546 [249390]
    Other proteins in same PDB: d3se6a1, d3se6a3, d3se6a4, d3se6a5, d3se6b1, d3se6b3, d3se6b4, d3se6b5
    automated match to d2yd0a2
    complexed with lys, mes, nag, zn

Details for d3se6b2

PDB Entry: 3se6 (more details), 3.08 Å

PDB Description: crystal structure of the human endoplasmic reticulum aminopeptidase 2
PDB Compounds: (B:) Endoplasmic reticulum aminopeptidase 2

SCOPe Domain Sequences for d3se6b2:

Sequence, based on SEQRES records: (download)

>d3se6b2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg
gvchsdpkmtsnmlaflgenaevkemmttwtlqkg

Sequence, based on observed residues (ATOM records): (download)

>d3se6b2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf
apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl
negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd
evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsaevkemmtt
wtlqkg

SCOPe Domain Coordinates for d3se6b2:

Click to download the PDB-style file with coordinates for d3se6b2.
(The format of our PDB-style files is described here.)

Timeline for d3se6b2: