![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries) |
![]() | Domain d3se6b2: 3se6 B:272-546 [249390] Other proteins in same PDB: d3se6a1, d3se6a3, d3se6a4, d3se6a5, d3se6b1, d3se6b3, d3se6b4, d3se6b5 automated match to d2yd0a2 complexed with lys, mes, nag, zn |
PDB Entry: 3se6 (more details), 3.08 Å
SCOPe Domain Sequences for d3se6b2:
Sequence, based on SEQRES records: (download)
>d3se6b2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsclesdftsg gvchsdpkmtsnmlaflgenaevkemmttwtlqkg
>d3se6b2 d.92.1.0 (B:272-546) automated matches {Human (Homo sapiens) [TaxId: 9606]} hslsgftssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdf apgamenwglityretsllfdpktssasdklwvtrviahelahqwfgnlvtmewwndiwl negfakymeliavnatypelqfddyflnvcfevitkdslnssrpiskpaetptqiqemfd evsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnsaevkemmtt wtlqkg
Timeline for d3se6b2: