PDB entry 3nyw

View 3nyw on RCSB PDB site
Description: Crystal Structure of a betaketoacyl-[ACP] reductase (FabG) from Bacteroides thetaiotaomicron
Class: oxidoreductase
Keywords: fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ binding, Rossmann fold, PSI-II, NYSGXRC, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Oxidoreductase, oxidation reduction, Mitochondria
Deposited on 2010-07-15, released 2010-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.236
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A562 (Start-241)
      • expression tag (242)
    Domains in SCOPe 2.07: d3nywa1, d3nywa2
  • Chain 'B':
    Compound: Putative oxidoreductase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nywb_
  • Chain 'C':
    Compound: Putative oxidoreductase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2380
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8A562 (Start-241)
      • expression tag (242)
    Domains in SCOPe 2.07: d3nywc1, d3nywc2
  • Chain 'D':
    Compound: Putative oxidoreductase
    Species: Bacteroides thetaiotaomicron [TaxId:818]
    Gene: BT_2380
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nywd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nywA (A:)
    mslekqkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqe
    pivlplditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinvia
    qygilktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplg
    irvttlcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkks
    iieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nywA (A:)
    kqkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivl
    plditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinviaqygi
    lktvteimkvqkngyifnvasadggiygstkfallglaeslyrelaplgirvttlcpgwv
    ntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkksiie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nywB (B:)
    mslekqkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqe
    pivlplditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinvia
    qygilktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplg
    irvttlcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkks
    iieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nywB (B:)
    qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
    lditdctkadteikdihqkygavdilvnaaamfmepvdnfrkimeinviaqygilktvte
    imkvqkngyifnvaadggiygstkfallglaeslyrelaplgirvttlcpgwvntdmakk
    fkdeemiqpddllntircllnlsenvcikdivfemkksii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nywC (C:)
    mslekqkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqe
    pivlplditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinvia
    qygilktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplg
    irvttlcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkks
    iieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nywC (C:)
    qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
    lditdctkadteikdihqkygavdilvnaaamfmsepvdnfrkimeinviaqygilktvt
    eimkvqkngyifnvasfadggiygstkfallglaeslyrelaplgirvttlcpgwvntdm
    akkagtpfkdeemiqpddllntircllnlsenvcikdivfemkksiie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nywD (D:)
    mslekqkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqe
    pivlplditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinvia
    qygilktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplg
    irvttlcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkks
    iieghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nywD (D:)
    qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
    lditdctkadteikdihqkygavdilvnaaamfmepvdnfrkimeinviaqygilktvte
    imkvqkngyifnvasrdggiygstkfallglaeslyrelaplgirvttlcpgwvndeemi
    qpddllntircllnlsenvcikdivfemkksii