Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:818] [225965] (1 PDB entry) |
Domain d3nywc1: 3nyw C:4-240 [214087] Other proteins in same PDB: d3nywa2, d3nywc2 automated match to d3p19d_ |
PDB Entry: 3nyw (more details), 2.16 Å
SCOPe Domain Sequences for d3nywc1:
Sequence, based on SEQRES records: (download)
>d3nywc1 c.2.1.0 (C:4-240) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp lditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinviaqygil ktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplgirvtt lcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkksii
>d3nywc1 c.2.1.0 (C:4-240) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]} qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp lditdctkadteikdihqkygavdilvnaaamfmsepvdnfrkimeinviaqygilktvt eimkvqkngyifnvasfadggiygstkfallglaeslyrelaplgirvttlcpgwvntdm akkagtpfkdeemiqpddllntircllnlsenvcikdivfemkksii
Timeline for d3nywc1:
View in 3D Domains from other chains: (mouse over for more information) d3nywa1, d3nywa2, d3nywb_, d3nywd_ |