Lineage for d3nywd_ (3nyw D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846153Species Bacteroides thetaiotaomicron [TaxId:818] [225965] (1 PDB entry)
  8. 2846157Domain d3nywd_: 3nyw D: [214088]
    Other proteins in same PDB: d3nywa2, d3nywc2
    automated match to d3p19d_

Details for d3nywd_

PDB Entry: 3nyw (more details), 2.16 Å

PDB Description: crystal structure of a betaketoacyl-[acp] reductase (fabg) from bacteroides thetaiotaomicron
PDB Compounds: (D:) Putative oxidoreductase

SCOPe Domain Sequences for d3nywd_:

Sequence, based on SEQRES records: (download)

>d3nywd_ c.2.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
lditdctkadteikdihqkygavdilvnaaamfmdgslsepvdnfrkimeinviaqygil
ktvteimkvqkngyifnvasraakygfadggiygstkfallglaeslyrelaplgirvtt
lcpgwvntdmakkagtpfkdeemiqpddllntircllnlsenvcikdivfemkksii

Sequence, based on observed residues (ATOM records): (download)

>d3nywd_ c.2.1.0 (D:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
qkglaiitgasqgigaviaaglatdgyrvvliarskqnlekvhdeimrsnkhvqepivlp
lditdctkadteikdihqkygavdilvnaaamfmepvdnfrkimeinviaqygilktvte
imkvqkngyifnvasrdggiygstkfallglaeslyrelaplgirvttlcpgwvndeemi
qpddllntircllnlsenvcikdivfemkksii

SCOPe Domain Coordinates for d3nywd_:

Click to download the PDB-style file with coordinates for d3nywd_.
(The format of our PDB-style files is described here.)

Timeline for d3nywd_: