PDB entry 3n0g

View 3n0g on RCSB PDB site
Description: Crystal Structure of Isoprene Synthase from Grey Poplar Leaves (Populus x canescens) in complex with three Mg2+ ions and dimethylallyl-S-thiolodiphosphate
Class: lyase
Keywords: terpene cyclase fold, hemiterpene synthase, ddxxd motif, nse/dte motif, dimethylallyl-s-thiolodiphosphate, lyase
Deposited on 2010-05-14, released 2010-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-10-06, with a file datestamp of 2010-10-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isoprene synthase
    Species: Populus tremula x Populus alba [TaxId:80863]
    Gene: ispS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AR86
      • engineered mutation (267)
      • engineered mutation (492)
    Domains in SCOPe 2.07: d3n0ga1, d3n0ga2
  • Chain 'B':
    Compound: Isoprene synthase
    Species: Populus tremula x Populus alba [TaxId:80863]
    Gene: ispS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9AR86
      • engineered mutation (267)
      • engineered mutation (492)
    Domains in SCOPe 2.07: d3n0gb1, d3n0gb2
  • Heterogens: DST, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n0gA (A:)
    mrgshhhhhhgsearrsadyepnswdydfllssdtdesievykdkakkleaevrreinne
    kaefltllelidnvqrlglgyrfesdirraldrfvssggfdgvtktslhatalsfrllrq
    hgfevsqeafsgfkdqngnflenlkedtkailslyeasflalegenildearvfaishlk
    elseekigkelaeqvnhalelplhrrtqrleavwsieayrkkedanqvllelaildynmi
    qsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafepqysdcrnsvakmfsf
    vtiiddiydvygtldelelftdaverwdvnaindlpdymklcflalyntineiaydnlkd
    kgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawksssgplqlifayfavv
    qnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetansvscymrtkgiseel
    atesvmnlidetwkkmnkeklggslfakpfvetainlarqshctyhngdahtspdeltrk
    rvlsvitepilpfer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0gA (A:)
    nswdydfllsvykdkakkleaevrreinnekaefltllelidnvqrlglgyrfesdirra
    ldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnflenlkedtka
    ilslyeasflalegenildearvfaishlkelseekigkelaeqvnhalelplhrrtqrl
    eavwsieayrkkedanqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardr
    liesfywavgvafepqysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvn
    aindlpdymklcflalyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynk
    stptfddyfgnawksssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcnd
    lasasaeiargetansvscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpf
    vetainlarqshctyhngtspdeltrkrvlsvitepilpfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n0gB (B:)
    mrgshhhhhhgsearrsadyepnswdydfllssdtdesievykdkakkleaevrreinne
    kaefltllelidnvqrlglgyrfesdirraldrfvssggfdgvtktslhatalsfrllrq
    hgfevsqeafsgfkdqngnflenlkedtkailslyeasflalegenildearvfaishlk
    elseekigkelaeqvnhalelplhrrtqrleavwsieayrkkedanqvllelaildynmi
    qsvyqrdlretsrwwrrvglatklhfardrliesfywavgvafepqysdcrnsvakmfsf
    vtiiddiydvygtldelelftdaverwdvnaindlpdymklcflalyntineiaydnlkd
    kgenilpyltkawadlcnaflqeakwlynkstptfddyfgnawksssgplqlifayfavv
    qnikkeeienlqkyhdiisrpshifrlcndlasasaeiargetansvscymrtkgiseel
    atesvmnlidetwkkmnkeklggslfakpfvetainlarqshctyhngdahtspdeltrk
    rvlsvitepilpfer
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n0gB (B:)
    nswdydfllsvykdkakkleaevrreinnekaefltllelidnvqrlglgyrfesdirra
    ldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnflenlkedtka
    ilslyeasflalegenildearvfaishlkelseekigkelaeqvnhalelplhrrtqrl
    eavwsieayrkkedanqvllelaildynmiqsvyqrdlretsrwwrrvglatklhfardr
    liesfywavgvafepqysdcrnsvakmfsfvtiiddiydvygtldelelftdaverwdvn
    aindlpdymklcflalyntineiaydnlkdkgenilpyltkawadlcnaflqeakwlynk
    stptfddyfgnawksssgplqlifayfavvqnikkeeienlqkyhdiisrpshifrlcnd
    lasasaeiargetansvscymrtkgiseelatesvmnlidetwkkmnkeklggslfakpf
    vetainlarqshctyhngdahtspdeltrkrvlsvitepilpfe