SCOPe 2.08: Domain d3n0gb1: 3n0g B:63-265

Lineage for d3n0gb1 (3n0g B:63-265)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Populus tremula [TaxId:80863] [225927] (2 PDB entries)

8. Domain d3n0gb1: 3n0g B:63-265 [213671]
   Other proteins in same PDB: d3n0ga2, d3n0gb2
   automated match to d1hxga1
   complexed with dst, mg

Details for d3n0gb1

PDB Entry: 3n0g, 2.8 Å

PDB Description: crystal structure of isoprene synthase from grey poplar leaves (populus x canescens) in complex with three mg2+ ions and dimethylallyl-s-thiolodiphosphate

PDB Compounds: (B:) Isoprene synthase

SCOPe Domain Sequences for d3n0gb1:

Sequence, based on SEQRES records:

>d3n0gb1 a.102.4.0 (B:63-265) automated matches {Populus tremula [TaxId: 80863]}
nswdydfllssdtdesievykdkakkleaevrreinnekaefltllelidnvqrlglgyr
fesdirraldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnfle
nlkedtkailslyeasflalegenildearvfaishlkelseekigkelaeqvnhalelp
lhrrtqrleavwsieayrkkeda

Sequence, based on observed residues (ATOM records):

>d3n0gb1 a.102.4.0 (B:63-265) automated matches {Populus tremula [TaxId: 80863]}
nswdydfllsvykdkakkleaevrreinnekaefltllelidnvqrlglgyrfesdirra
ldrfvssggfdgvtktslhatalsfrllrqhgfevsqeafsgfkdqngnflenlkedtka
ilslyeasflalegenildearvfaishlkelseekigkelaeqvnhalelplhrrtqrl
eavwsieayrkkeda

Timeline for d3n0gb1:

• d3n0gb1 first appeared in SCOPe 2.03
  
• d3n0gb1 appears in SCOPe 2.07