PDB entry 3mxg

View 3mxg on RCSB PDB site
Description: Structure of Shiga Toxin type 2 (Stx2) B Pentamer Mutant Q40L
Class: toxin
Keywords: Stx2B pentamer, shiga toxin, TOXIN
Deposited on 2010-05-07, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxga_
  • Chain 'B':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgb_
  • Chain 'C':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgc_
  • Chain 'D':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgd_
  • Chain 'E':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxge_
  • Chain 'F':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgf_
  • Chain 'G':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgg_
  • Chain 'H':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgh_
  • Chain 'I':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgi_
  • Chain 'J':
    Compound: Shiga-like toxin 2 subunit B
    Species: Escherichia coli [TaxId:83334]
    Gene: stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UQX3 (0-69)
      • engineered mutation (39)
    Domains in SCOPe 2.07: d3mxgj_
  • Heterogens: XLS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgA (A:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgB (B:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgC (C:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgD (D:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgE (E:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgF (F:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgG (G:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgH (H:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgI (I:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3mxgJ (J:)
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd