Lineage for d3mxge_ (3mxg E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2397831Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2398373Protein automated matches [190381] (11 species)
    not a true protein
  7. 2398402Species Escherichia coli O157:H7 [TaxId:83334] [189598] (1 PDB entry)
  8. 2398407Domain d3mxge_: 3mxg E: [181670]
    automated match to d1r4pb_
    complexed with xls; mutant

Details for d3mxge_

PDB Entry: 3mxg (more details), 2.49 Å

PDB Description: structure of shiga toxin type 2 (stx2) b pentamer mutant q40l
PDB Compounds: (E:) Shiga-like toxin 2 subunit B

SCOPe Domain Sequences for d3mxge_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mxge_ b.40.2.1 (E:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
adcakgkiefskyneddtftvkvdgkeywtsrwnlqplllsaqltgmtvtiksstcesgs
gfaevqfnnd

SCOPe Domain Coordinates for d3mxge_:

Click to download the PDB-style file with coordinates for d3mxge_.
(The format of our PDB-style files is described here.)

Timeline for d3mxge_: