PDB entry 3lvk

View 3lvk on RCSB PDB site
Description: Crystal Structure of E.coli IscS-TusA complex (form 2)
Class: transferase
Keywords: protein-protein complex, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Transferase, tRNA thiolation, sulfur transfer
Deposited on 2010-02-22, released 2010-04-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-05-05, with a file datestamp of 2010-04-30.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.209
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cysteine desulfurase
  Species: Escherichia coli [TaxId:155864]
  Gene: iscS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A6B9 (19-End)
• Chain 'B':
  Compound: Sulfurtransferase tusA
  Species: Escherichia coli [TaxId:155864]
  Gene: tusA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A892
  Domains in SCOPe 2.02: d3lvkb_
• Heterogens: PLP, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >3lvkB (B:)
  gstdlfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfm
  ehelvaketdglpyrylirkgg
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3lvkB (B:)
  lfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfmehel
  vaketdglpyrylirk