Lineage for d3lvkb_ (3lvk B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208441Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1208610Superfamily d.68.3: SirA-like [64307] (1 family) (S)
  5. 1208611Family d.68.3.3: SirA-like [88852] (5 proteins)
    predicted redox protein, regulator of disulfide bond formation
  6. 1208624Protein automated matches [191153] (1 species)
    not a true protein
  7. 1208625Species Escherichia coli [TaxId:155864] [189315] (2 PDB entries)
  8. 1208626Domain d3lvkb_: 3lvk B: [180593]
    automated match to d1dcja_
    protein/RNA complex; complexed with plp

Details for d3lvkb_

PDB Entry: 3lvk (more details), 2.44 Å

PDB Description: crystal structure of e.coli iscs-tusa complex (form 2)
PDB Compounds: (B:) Sulfurtransferase tusA

SCOPe Domain Sequences for d3lvkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvkb_ d.68.3.3 (B:) automated matches {Escherichia coli [TaxId: 155864]}
lfsspdhtldalglrcpepvmmvrktvrnmqpgetlliiaddpattrdipgfctfmehel
vaketdglpyrylirk

SCOPe Domain Coordinates for d3lvkb_:

Click to download the PDB-style file with coordinates for d3lvkb_.
(The format of our PDB-style files is described here.)

Timeline for d3lvkb_: