PDB entry 3gcg

View 3gcg on RCSB PDB site
Description: crystal structure of MAP and CDC42 complex
Class: signaling protein/transcription
Keywords: MAP, CDC42, COMPLEX, Alternative splicing, Cell membrane, GTP-binding, Lipoprotein, Membrane, Methylation, Nucleotide-binding, Prenylation cdc42, SIGNALING PROTEIN/TRANSCRIPTION COMPLEX
Deposited on 2009-02-22, released 2009-07-21
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-10-27, with a file datestamp of 2009-10-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division control protein 42 homolog
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60953 (5-181)
      • see remark 999 (166)
    Domains in SCOPe 2.02: d3gcga_
  • Chain 'B':
    Compound: L0028 (Mitochondria associated protein)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gcgA (A:)
    gplgsqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
    dtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
    idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gcgA (A:)
    qtikcvvvgdgavgktcllisyttneyvptvfdnyavtvmiggepytlglfdtagqedyd
    rlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddpst
    ieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale
    

  • Chain 'B':
    No sequence available.