SCOPe 2.02: Domain d3gcga_: 3gcg A:

Lineage for d3gcga_ (3gcg A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Homo sapiens [TaxId:9606] [192727] (8 PDB entries)

8. Domain d3gcga_: 3gcg A: [196554]
   automated match to d1ajea_

Details for d3gcga_

PDB Entry: 3gcg, 2.3 Å

PDB Description: crystal structure of MAP and CDC42 complex

PDB Compounds: (A:) Cell division control protein 42 homolog

SCOPe Domain Sequences for d3gcga_:

Sequence, based on SEQRES records:

>d3gcga_ c.37.1.8 (A:) automated matches {Homo sapiens [TaxId: 9606]}
qtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtagq
edydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrd
dpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

Sequence, based on observed residues (ATOM records):

>d3gcga_ c.37.1.8 (A:) automated matches {Homo sapiens [TaxId: 9606]}
qtikcvvvgdgavgktcllisyttneyvptvfdnyavtvmiggepytlglfdtagqedyd
rlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddpst
ieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

Timeline for d3gcga_:

• d3gcga_ is new in SCOPe 2.02-stable
  
• d3gcga_ appears in SCOPe 2.03
  
• d3gcga_ appears in the current release, SCOPe 2.08