PDB entry 3gbl

View 3gbl on RCSB PDB site
Description: Crystal structure of grass carp Beta2-microglobulin
Class: immune system
Keywords: Beta2-microglobulin, Immune response, Immunoglobulin domain, MHC I, Secreted, IMMUNE SYSTEM
Deposited on 2009-02-20, released 2010-03-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-03-16, with a file datestamp of 2010-03-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta2-microglobulin
    Species: Ctenopharyngodon idella [TaxId:7959]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3gbla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gblA (A:)
    kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw
    qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm