SCOPe 2.04: Domain d3gbla_: 3gbl A:

Lineage for d3gbla_ (3gbl A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Ctenopharyngodon idella [TaxId:7959] [189272] (1 PDB entry)

8. Domain d3gbla_: 3gbl A: [176501]
   automated match to d1a1mb_

Details for d3gbla_

PDB Entry: 3gbl, 2.1 Å

PDB Description: Crystal structure of grass carp Beta2-microglobulin

PDB Compounds: (A:) beta2-microglobulin

SCOPe Domain Sequences for d3gbla_:

Sequence; same for both SEQRES and ATOM records:

>d3gbla_ b.1.1.0 (A:) automated matches {Ctenopharyngodon idella [TaxId: 7959]}
kvsspkiqvyshypgeygkentlicyvsgfhppdisiellkngeviadaqqtdlafekgw
qfhltksvsfkpeksdeyscsvrhmsktkkivwesnm

Timeline for d3gbla_:

• d3gbla_ first appeared in SCOPe 2.01
  
• d3gbla_ appears in SCOPe 2.03
  
• d3gbla_ appears in SCOPe 2.05
  
• d3gbla_ appears in the current release, SCOPe 2.08