PDB entry 3dxs

View 3dxs on RCSB PDB site
Description: Crystal structure of a copper binding domain from HMA7, a P-type ATPase
Class: hydrolase
Keywords: copper transport, cxxc motif, ferredoxin-like fold, ATP-binding, Copper, Ethylene signaling pathway, Hydrolase, Ion transport, Magnesium, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, Transmembrane, Transport
Deposited on 2008-07-25, released 2009-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.142
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Copper-transporting ATPase RAN1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: RAN1, At5g44790, K23L20.14, T19K24.18
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9S7J8 (1-73)
      • initiating methionine (0)
      • conflict (58)
      • engineered (73)
    Domains in SCOPe 2.07: d3dxsx_
  • Heterogens: ZN, LI, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3dxsX (X:)
mrkiqvgvtgmtcaacsnsveaalmnvngvfkasvallqnradvvfdpnlvkeedikeei
edagfeaeilaeew